PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00355.1.p
Common NameEUGRSUZ_A00355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GRAS
Protein Properties Length: 526aa    MW: 59633.5 Da    PI: 4.983
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00355.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS272.41.4e-831535232374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl....fsevsPi 90 
                        e Ll +Ae v  +++ +a++lL++  el+ ++g+p++R++ y+ eAL++++ r++ +++ +   ++ +  + +e ++  +      +++ P+
  Eucgr.A00355.1.p 153 AEILLGAAEKVGCQQFDAASELLNQCDELCCNTGNPVERVVYYISEALREKIDRETGRISIKGLGKKMN-LDLDEDIMRPSPpimlSHQLVPF 244
                       5789**************************************************777777555444444.3345554443223343889**** PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                        +++++ a q+I+e v+++++vH++Df+i  G+QW  L+qaL +R+  +   l+iT++g     s++++e tg+rL+ fA+ ++vpf+f++++
  Eucgr.A00355.1.p 245 SQIQQFSAIQTIMENVAEAKKVHVVDFGIWSGVQWTVLMQALMNRReCSLELLKITALGT---CSQQAIEDTGKRLETFARLFHVPFSFKIIM 334
                       ******************************************9888356679********...689*************************** PP

              GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++ +l+ + ++++++E ++V   + l+++  ++  les    v+k++k+l+P v+vv+e e++hns+ F +rf e l yysa fd+le+  
  Eucgr.A00355.1.p 335 LQDMLELKEDLFDLDKEEFIVVYARFLLKTMIPQPERLES----VMKVIKKLNPCVMVVTEVESNHNSPAFTHRFPEVLFYYSAYFDCLEECT 423
                       *******************************988888888....*********************************************9999 PP

              GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                        r++e+r+++E ++lg+ i+ ++a+eg+er+ r+ +   Wr+ ++++G+ +v l++    qa+l+++k++ +   +++ + ++l++gWk+ p+
  Eucgr.A00355.1.p 424 ERDDENRTVLESVYLGQGIRTILAAEGEERNIRNIKIDVWRAFFSRFGMVEVDLGTASLYQANLMVKKFPcGSSCTLDMNGKCLIIGWKGTPI 516
                       **********************************************************************9999******************* PP

              GRAS 368 vsvSaWr 374
                        s+SaW+
  Eucgr.A00355.1.p 517 HSLSAWQ 523
                       ******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.466126502IPR005202Transcription factor GRAS
PfamPF035145.0E-81153523IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MKKQAPFSEY QRQEQLQQLL SDYGLLDNLQ YDIASPPIQT SLDEIAKFSR ISTELQDIIE  60
ARKDKPFQFP LTSLELLKNC GSRLRQLSGD GVLNPNTENN KAELSASETM RIASAKFIQS  120
SSVAAVDLVL PGHPHDYHFS CSSEDEVRNV QLAEILLGAA EKVGCQQFDA ASELLNQCDE  180
LCCNTGNPVE RVVYYISEAL REKIDRETGR ISIKGLGKKM NLDLDEDIMR PSPPIMLSHQ  240
LVPFSQIQQF SAIQTIMENV AEAKKVHVVD FGIWSGVQWT VLMQALMNRR ECSLELLKIT  300
ALGTCSQQAI EDTGKRLETF ARLFHVPFSF KIIMLQDMLE LKEDLFDLDK EEFIVVYARF  360
LLKTMIPQPE RLESVMKVIK KLNPCVMVVT EVESNHNSPA FTHRFPEVLF YYSAYFDCLE  420
ECTERDDENR TVLESVYLGQ GIRTILAAEG EERNIRNIKI DVWRAFFSRF GMVEVDLGTA  480
SLYQANLMVK KFPCGSSCTL DMNGKCLIIG WKGTPIHSLS AWQFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3617052322375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00355.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064981.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A059DB600.0A0A059DB60_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-47RGA-like 2